PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 517aa    MW: 56679.9 Da    PI: 5.2973
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019232genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.55.7e-28243300260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK v+g++f rsYY+Ct+++Cp+kk+vers+ ++ +++i  +g+H+h+k
  DCAR_019232 243 DDGYNWRKYGQKLVRGNQFVRSYYKCTFPSCPAKKQVERSH-EGYITNINCRGNHEHPK 300
                  8****************************************.***************85 PP

2WRKY35.42.1e-11422444123
                  ---SS-EEEEEEE--TT-SS-EE CS
         WRKY   1 ldDgynWrKYGqKevkgsefprs 23 
                  ++Dgy+WrKYGqK vkg+ +prs
  DCAR_019232 422 VNDGYRWRKYGQKLVKGNSNPRS 444
                  58********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-24237301IPR003657WRKY domain
SuperFamilySSF1182905.23E-22239301IPR003657WRKY domain
SMARTSM007744.4E-27242300IPR003657WRKY domain
PfamPF031062.8E-21243299IPR003657WRKY domain
PROSITE profilePS5081120.576243301IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.0E-11408444IPR003657WRKY domain
SuperFamilySSF1182901.96E-8415444IPR003657WRKY domain
PROSITE profilePS5081113.528417444IPR003657WRKY domain
SMARTSM007741.9E-4422470IPR003657WRKY domain
PfamPF031062.7E-7423444IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MVTSMEGMGD AISADKLQQG ENLDAVFHDS VSNQKGTPHS VIRTREEPLK LNQRQSLFEP  60
VILQVRQESS IDQVKPEKGL TNVKLAQSLD DVADASQPNK DESSISIVHE TEPVTLCQRP  120
SLDGTTPTSE SCQERSSLST VPEKELDNLQ PTPNLSTVIL TSEHGTPVST MPANVPDTLQ  180
KIIDHETYLS ASQSDQEKSS LSLKQAKILE KLPLRRNPDV GVQTLPSVQE GSGRSKLPEK  240
PSDDGYNWRK YGQKLVRGNQ FVRSYYKCTF PSCPAKKQVE RSHEGYITNI NCRGNHEHPK  300
PQPSPQTPVS VQASSPEKSS LVGSEVPRSE DETANIDMEK PHQIVLVESP KPLPVQAKSP  360
DVMGVSASKS NRAKDRDDHD GEMDTKRRRR DSSISDDNLA SANRANGESR IVIQTTSLVD  420
IVNDGYRWRK YGQKLVKGNS NPRSPVFPVK ILACDGAFPF CYTDIHILGG ADTDVTPQNA  480
SGADTDVAPQ NSESRSETEE KEVAGLDMVV HVSETE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-142432991877Probable WRKY transcription factor 4
2lex_A5e-142432991877Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-37WRKY family protein